SCOP 1.67: Domain d1hysa1: 1hys A:430-553

Lineage for d1hysa1 (1hys A:430-553)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (9 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (73 PDB entries)

8. Domain d1hysa1: 1hys A:430-553 [61417]
   Other proteins in same PDB: d1hysa2, d1hysb_, d1hysc1, d1hysc2, d1hysd1, d1hysd2
   mutant

Details for d1hysa1

PDB Entry: 1hys, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna

SCOP Domain Sequences for d1hysa1:

Sequence; same for both SEQRES and ATOM records:

>d1hysa1 c.55.3.1 (A:430-553) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvs

Timeline for d1hysa1:

• d1hysa1 first appeared in SCOP 1.57
  
• d1hysa1 appears in SCOP 1.65
  
• d1hysa1 appears in SCOP 1.69
  
• d1hysa1 appears in the current release, SCOPe 2.08