| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() consists of one domain of this fold |
| Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
| Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries) |
| Domain d1hysa1: 1hys A:430-553 [61417] Other proteins in same PDB: d1hysa2, d1hysb_, d1hysc1, d1hysc2, d1hysd1, d1hysd2 mutant |
PDB Entry: 1hys (more details), 3 Å
SCOP Domain Sequences for d1hysa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hysa1 c.55.3.1 (A:430-553) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvs
Timeline for d1hysa1: