Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries) |
Domain d1hyrc1: 1hyr C:181-274 [61415] Other proteins in same PDB: d1hyra_, d1hyrb_, d1hyrc2 |
PDB Entry: 1hyr (more details), 2.7 Å
SCOPe Domain Sequences for d1hyrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt yqtwvatricqgeeqrftcymehsgnhsthpvps
Timeline for d1hyrc1: