Lineage for d1hyrc1 (1hyr C:181-274)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 160246Protein MHC I homolog [48967] (3 species)
  7. 160247Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries)
  8. 160248Domain d1hyrc1: 1hyr C:181-274 [61415]
    Other proteins in same PDB: d1hyra_, d1hyrb_, d1hyrc2

Details for d1hyrc1

PDB Entry: 1hyr (more details), 2.7 Å

PDB Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d

SCOP Domain Sequences for d1hyrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyrc1 b.1.1.2 (C:181-274) MHC I homolog {Human (Homo sapiens), Mic-a}
tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
yqtwvatricqgeeqrftcymehsgnhsthpvps

SCOP Domain Coordinates for d1hyrc1:

Click to download the PDB-style file with coordinates for d1hyrc1.
(The format of our PDB-style files is described here.)

Timeline for d1hyrc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyrc2