Lineage for d1hyea2 (1hye A:146-313)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420814Protein MJ0490, lactate/malate dehydrogenase [64446] (1 species)
  7. 420815Species Archaeon Methanococcus jannaschii [TaxId:2190] [64447] (2 PDB entries)
  8. 420816Domain d1hyea2: 1hye A:146-313 [61401]
    Other proteins in same PDB: d1hyea1
    complexed with nap

Details for d1hyea2

PDB Entry: 1hye (more details), 1.9 Å

PDB Description: crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure

SCOP Domain Sequences for d1hyea2:

Sequence, based on SEQRES records: (download)

>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii}
lgthldslrfkvaiakffgvhidevrtriigehgdsmvpllsatsiggipiqkferfkel
pideiiedvktkgeqiirlkggsefgpaaailnvvrcivnnekrlltlsayvdgefdgir
dvcigvpvkigrdgieevvsieldkdeiiafrksaeiikkyceevknl

Sequence, based on observed residues (ATOM records): (download)

>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii}
lgthldslrfkvaiakffgvhidevrtriigehgdsmvpllsatsiggipiqkferfkel
pideiiedvktkgeqiirfgpaaailnvvrcivnnekrlltlsayvdgefdgirdvcigv
pvkigrdgieevvsieldkdeiiafrksaeiikkyceevknl

SCOP Domain Coordinates for d1hyea2:

Click to download the PDB-style file with coordinates for d1hyea2.
(The format of our PDB-style files is described here.)

Timeline for d1hyea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hyea1