SCOPe 2.02: Domain d1hxyd2: 1hxy D:102-213

Lineage for d1hxyd2 (1hxy D:102-213)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54347] (4 PDB entries)

8. Domain d1hxyd2: 1hxy D:102-213 [61391]
   Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyb2, d1hxyd1
   complexed with zn

Details for d1hxyd2

PDB Entry: 1hxy, 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

PDB Compounds: (D:) enterotoxin h

SCOPe Domain Sequences for d1hxyd2:

Sequence; same for both SEQRES and ATOM records:

>d1hxyd2 d.15.6.1 (D:102-213) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlyt

Timeline for d1hxyd2:

• d1hxyd2 first appeared in SCOP 1.57
  
• d1hxyd2 appears in SCOPe 2.01
  
• d1hxyd2 appears in SCOPe 2.03
  
• d1hxyd2 appears in the current release, SCOPe 2.08