Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) |
Protein Staphylococcal enterotoxin H, SEH [54346] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54347] (4 PDB entries) |
Domain d1hxyd2: 1hxy D:102-213 [61391] Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyb2, d1hxyd1 |
PDB Entry: 1hxy (more details), 2.6 Å
SCOP Domain Sequences for d1hxyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxyd2 d.15.6.1 (D:102-213) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus} eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlyt
Timeline for d1hxyd2:
View in 3D Domains from other chains: (mouse over for more information) d1hxya1, d1hxya2, d1hxyb1, d1hxyb2 |