Lineage for d1hxyd1 (1hxy D:2-101)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949887Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 949950Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 949951Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)
  8. 949956Domain d1hxyd1: 1hxy D:2-101 [61390]
    Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyb2, d1hxyd2
    complexed with zn

Details for d1hxyd1

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
PDB Compounds: (D:) enterotoxin h

SCOPe Domain Sequences for d1hxyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxyd1 b.40.2.2 (D:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

SCOPe Domain Coordinates for d1hxyd1:

Click to download the PDB-style file with coordinates for d1hxyd1.
(The format of our PDB-style files is described here.)

Timeline for d1hxyd1: