Lineage for d1hxyb2 (1hxy B:3-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897932Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1897942Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (17 PDB entries)
  8. 1897952Domain d1hxyb2: 1hxy B:3-92 [61389]
    Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb1, d1hxyd1, d1hxyd2
    complexed with zn

Details for d1hxyb2

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1hxyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxyb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1hxyb2:

Click to download the PDB-style file with coordinates for d1hxyb2.
(The format of our PDB-style files is described here.)

Timeline for d1hxyb2: