Lineage for d1hxyb2 (1hxy B:3-92)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255412Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries)
  8. 255426Domain d1hxyb2: 1hxy B:3-92 [61389]
    Other proteins in same PDB: d1hxya1, d1hxyb1, d1hxyd1, d1hxyd2
    complexed with zn

Details for d1hxyb2

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

SCOP Domain Sequences for d1hxyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxyb2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1hxyb2:

Click to download the PDB-style file with coordinates for d1hxyb2.
(The format of our PDB-style files is described here.)

Timeline for d1hxyb2: