SCOPe 2.02: Domain d1hxyb1: 1hxy B:93-190

Lineage for d1hxyb1 (1hxy B:93-190)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d1hxyb1: 1hxy B:93-190 [61388]
   Other proteins in same PDB: d1hxya1, d1hxya2, d1hxyb2, d1hxyd1, d1hxyd2
   complexed with zn

Details for d1hxyb1

PDB Entry: 1hxy, 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1hxyb1:

Sequence, based on SEQRES records:

>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvyphnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

Timeline for d1hxyb1:

• d1hxyb1 first appeared in SCOP 1.57
  
• d1hxyb1 appears in SCOPe 2.01
  
• d1hxyb1 appears in SCOPe 2.03
  
• d1hxyb1 appears in the current release, SCOPe 2.08