![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (6 PDB entries) |
![]() | Domain d1hxyb1: 1hxy B:93-190 [61388] Other proteins in same PDB: d1hxya2, d1hxyb2, d1hxyd1, d1hxyd2 |
PDB Entry: 1hxy (more details), 2.6 Å
SCOP Domain Sequences for d1hxyb1:
Sequence, based on SEQRES records: (download)
>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} rrvepkvtvyphnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvm letvprsgevytcqvehpsvtspltvewra
Timeline for d1hxyb1:
![]() Domains from other chains: (mouse over for more information) d1hxya1, d1hxya2, d1hxyd1, d1hxyd2 |