SCOP 1.59: Domain d1hxyb1: 1hxy B:93-190

Lineage for d1hxyb1 (1hxy B:93-190)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (6 PDB entries)

8. Domain d1hxyb1: 1hxy B:93-190 [61388]
   Other proteins in same PDB: d1hxya2, d1hxyb2, d1hxyd1, d1hxyd2

Details for d1hxyb1

PDB Entry: 1hxy, 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

SCOP Domain Sequences for d1hxyb1:

Sequence, based on SEQRES records:

>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d1hxyb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvyphnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvm
letvprsgevytcqvehpsvtspltvewra

Timeline for d1hxyb1:

• d1hxyb1 first appeared in SCOP 1.57
  
• d1hxyb1 appears in SCOP 1.61
  
• d1hxyb1 appears in the current release, SCOPe 2.08