Lineage for d1hxya2 (1hxy A:3-81)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78785Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species)
  7. 78792Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (6 PDB entries)
  8. 78801Domain d1hxya2: 1hxy A:3-81 [61387]
    Other proteins in same PDB: d1hxya1, d1hxyb1, d1hxyd1, d1hxyd2

Details for d1hxya2

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

SCOP Domain Sequences for d1hxya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxya2 d.19.1.1 (A:3-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1hxya2:

Click to download the PDB-style file with coordinates for d1hxya2.
(The format of our PDB-style files is described here.)

Timeline for d1hxya2: