Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
Domain d1hxya1: 1hxy A:82-182 [61386] Other proteins in same PDB: d1hxya2, d1hxyb1, d1hxyb2, d1hxyd1, d1hxyd2 complexed with zn |
PDB Entry: 1hxy (more details), 2.6 Å
SCOPe Domain Sequences for d1hxya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxya1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
Timeline for d1hxya1:
View in 3D Domains from other chains: (mouse over for more information) d1hxyb1, d1hxyb2, d1hxyd1, d1hxyd2 |