Lineage for d1hxya1 (1hxy A:82-182)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453045Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 453053Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 453073Domain d1hxya1: 1hxy A:82-182 [61386]
    Other proteins in same PDB: d1hxya2, d1hxyb1, d1hxyb2, d1hxyd1, d1hxyd2

Details for d1hxya1

PDB Entry: 1hxy (more details), 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

SCOP Domain Sequences for d1hxya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxya1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOP Domain Coordinates for d1hxya1:

Click to download the PDB-style file with coordinates for d1hxya1.
(The format of our PDB-style files is described here.)

Timeline for d1hxya1: