SCOP 1.67: Domain d1hxya1: 1hxy A:82-182

Lineage for d1hxya1 (1hxy A:82-182)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (25 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1hxya1: 1hxy A:82-182 [61386]
   Other proteins in same PDB: d1hxya2, d1hxyb1, d1hxyb2, d1hxyd1, d1hxyd2
   complexed with zn

Details for d1hxya1

PDB Entry: 1hxy, 2.6 Å

PDB Description: crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii

SCOP Domain Sequences for d1hxya1:

Sequence; same for both SEQRES and ATOM records:

>d1hxya1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1hxya1:

• d1hxya1 first appeared in SCOP 1.57
  
• d1hxya1 appears in SCOP 1.65
  
• d1hxya1 appears in SCOP 1.69
  
• d1hxya1 appears in the current release, SCOPe 2.08