Lineage for d1hxmh2 (1hxm H:124-230)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517073Protein T-cell antigen receptor [49125] (7 species)
  7. 1517147Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (2 PDB entries)
  8. 1517151Domain d1hxmh2: 1hxm H:124-230 [61382]
    Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1
    complexed with so4

Details for d1hxmh2

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (H:) gamma-delta T-cell receptor

SCOPe Domain Sequences for d1hxmh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmh2 b.1.1.2 (H:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
kqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsqegn
tmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi

SCOPe Domain Coordinates for d1hxmh2:

Click to download the PDB-style file with coordinates for d1hxmh2.
(The format of our PDB-style files is described here.)

Timeline for d1hxmh2: