SCOP 1.61: Domain d1hxmh1: 1hxm H:1-123

Lineage for d1hxmh1 (1hxm H:1-123)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (2 PDB entries)

8. Domain d1hxmh1: 1hxm H:1-123 [61381]
   Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2

Details for d1hxmh1

PDB Entry: 1hxm, 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

SCOP Domain Sequences for d1hxmh1:

Sequence; same for both SEQRES and ATOM records:

>d1hxmh1 b.1.1.1 (H:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
itd

Timeline for d1hxmh1:

• d1hxmh1 first appeared in SCOP 1.57
  
• d1hxmh1 appears in SCOP 1.59
  
• d1hxmh1 appears in SCOP 1.63
  
• d1hxmh1 appears in the current release, SCOPe 2.08