Lineage for d1hxmg1 (1hxm G:1-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354864Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2354955Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries)
  8. 2354959Domain d1hxmg1: 1hxm G:1-120 [61379]
    Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2
    complexed with so4

Details for d1hxmg1

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (G:) gamma-delta T-cell receptor

SCOPe Domain Sequences for d1hxmg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmg1 b.1.1.1 (G:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr

SCOPe Domain Coordinates for d1hxmg1:

Click to download the PDB-style file with coordinates for d1hxmg1.
(The format of our PDB-style files is described here.)

Timeline for d1hxmg1: