Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (1 PDB entry) |
Domain d1hxmf2: 1hxm F:124-230 [61378] Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1 |
PDB Entry: 1hxm (more details), 3.12 Å
SCOP Domain Sequences for d1hxmf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxmf2 b.1.1.2 (F:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain} kqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsqegn tmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
Timeline for d1hxmf2: