Lineage for d1hxmb2 (1hxm B:124-230)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786898Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (2 PDB entries)
  8. 786899Domain d1hxmb2: 1hxm B:124-230 [61370]
    Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1

Details for d1hxmb2

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (B:) gamma-delta T-cell receptor

SCOP Domain Sequences for d1hxmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]}
kqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsqegn
tmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi

SCOP Domain Coordinates for d1hxmb2:

Click to download the PDB-style file with coordinates for d1hxmb2.
(The format of our PDB-style files is described here.)

Timeline for d1hxmb2: