Lineage for d1hxmb2 (1hxm B:124-230)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550341Protein T-cell antigen receptor [49125] (6 species)
  7. 550365Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (1 PDB entry)
  8. 550366Domain d1hxmb2: 1hxm B:124-230 [61370]
    Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1

Details for d1hxmb2

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

SCOP Domain Sequences for d1hxmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
kqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsqegn
tmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi

SCOP Domain Coordinates for d1hxmb2:

Click to download the PDB-style file with coordinates for d1hxmb2.
(The format of our PDB-style files is described here.)

Timeline for d1hxmb2: