Lineage for d1hxma1 (1hxm A:1-120)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220348Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (1 PDB entry)
  8. 220349Domain d1hxma1: 1hxm A:1-120 [61367]
    Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2

Details for d1hxma1

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
PDB Compounds: (A:)

SCOP Domain Sequences for d1hxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain}
aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr

SCOP Domain Coordinates for d1hxma1:

Click to download the PDB-style file with coordinates for d1hxma1.
(The format of our PDB-style files is described here.)

Timeline for d1hxma1: