Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (1 protein) |
Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species) |
Species Escherichia coli [TaxId:562] [55709] (3 PDB entries) |
Domain d1hxda3: 1hxd A:64-270 [61362] Other proteins in same PDB: d1hxda1, d1hxda2, d1hxdb1, d1hxdb2 |
PDB Entry: 1hxd (more details), 2.4 Å
SCOP Domain Sequences for d1hxda3:
Sequence, based on SEQRES records: (download)
>d1hxda3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli relraalelfeqeglapylsrwekldn
>d1hxda3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltgktgdaaqivigaginmamqgwitlqeaginldrntlaamlirelraalel feqeglapylsrwekldn
Timeline for d1hxda3: