Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.1: Biotin repressor (BirA) [50038] (2 proteins) automatically mapped to Pfam PF02237 |
Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) |
Species Escherichia coli [TaxId:562] [50040] (4 PDB entries) |
Domain d1hxda2: 1hxd A:271-317 [61361] Other proteins in same PDB: d1hxda1, d1hxda3, d1hxdb1, d1hxdb3 complexed with btn |
PDB Entry: 1hxd (more details), 2.4 Å
SCOPe Domain Sequences for d1hxda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxda2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr
Timeline for d1hxda2: