Lineage for d1hv2a_ (1hv2 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903246Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1903304Protein Elongin C [54699] (3 species)
  7. 1903305Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64261] (1 PDB entry)
  8. 1903306Domain d1hv2a_: 1hv2 A: [61287]
    complexed with a von Hippel-Lindau peptide, chain B

Details for d1hv2a_

PDB Entry: 1hv2 (more details)

PDB Description: solution structure of yeast elongin c in complex with a von hippel- lindau peptide
PDB Compounds: (A:) elongin c

SCOPe Domain Sequences for d1hv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msqdfvtlvskddkeyeisrsaamisptlkamiegpfreskgrielkqfdshilekavey
lnynlkysgvsedddeipefeiptemslelllaadylsi

SCOPe Domain Coordinates for d1hv2a_:

Click to download the PDB-style file with coordinates for d1hv2a_.
(The format of our PDB-style files is described here.)

Timeline for d1hv2a_: