Lineage for d1hv2a_ (1hv2 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602160Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 602161Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 602162Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 602190Protein Elongin C [54699] (2 species)
  7. 602191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64261] (1 PDB entry)
  8. 602192Domain d1hv2a_: 1hv2 A: [61287]
    complexed with a von Hippel-Lindau peptide, chain B

Details for d1hv2a_

PDB Entry: 1hv2 (more details)

PDB Description: solution structure of yeast elongin c in complex with a von hippel- lindau peptide

SCOP Domain Sequences for d1hv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae)}
msqdfvtlvskddkeyeisrsaamisptlkamiegpfreskgrielkqfdshilekavey
lnynlkysgvsedddeipefeiptemslelllaadylsi

SCOP Domain Coordinates for d1hv2a_:

Click to download the PDB-style file with coordinates for d1hv2a_.
(The format of our PDB-style files is described here.)

Timeline for d1hv2a_: