Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
Protein Elongin C [54699] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64261] (1 PDB entry) |
Domain d1hv2a_: 1hv2 A: [61287] complexed with a von Hippel-Lindau peptide, chain B |
PDB Entry: 1hv2 (more details)
SCOP Domain Sequences for d1hv2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae)} msqdfvtlvskddkeyeisrsaamisptlkamiegpfreskgrielkqfdshilekavey lnynlkysgvsedddeipefeiptemslelllaadylsi
Timeline for d1hv2a_: