Lineage for d1huzb1 (1huz B:10-91)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444386Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 444387Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 444388Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 444482Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 444486Domain d1huzb1: 1huz B:10-91 [61283]
    Other proteins in same PDB: d1huza3, d1huza4, d1huzb3, d1huzb4

Details for d1huzb1

PDB Entry: 1huz (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase complexed with dna and cr-pcp
PDB Compounds: (B:)

SCOP Domain Sequences for d1huzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huzb1 a.60.6.1 (B:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOP Domain Coordinates for d1huzb1:

Click to download the PDB-style file with coordinates for d1huzb1.
(The format of our PDB-style files is described here.)

Timeline for d1huzb1: