Lineage for d1huza2 (1huz A:92-334)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200829Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 200830Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 200922Species Rat (Rattus norvegicus) [TaxId:10116] [56703] (17 PDB entries)
  8. 200930Domain d1huza2: 1huz A:92-334 [61282]
    Other proteins in same PDB: d1huza1, d1huzb1

Details for d1huza2

PDB Entry: 1huz (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase complexed with dna and cr-pcp

SCOP Domain Sequences for d1huza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huza2 e.9.1.1 (A:92-334) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekrip
reemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkll
hrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepk
drs

SCOP Domain Coordinates for d1huza2:

Click to download the PDB-style file with coordinates for d1huza2.
(The format of our PDB-style files is described here.)

Timeline for d1huza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1huza1