Lineage for d1huoa2 (1huo A:92-334)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200829Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 200830Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 200922Species Rat (Rattus norvegicus) [TaxId:10116] [56703] (17 PDB entries)
  8. 200928Domain d1huoa2: 1huo A:92-334 [61274]
    Other proteins in same PDB: d1huoa1, d1huob1

Details for d1huoa2

PDB Entry: 1huo (more details), 2.6 Å

PDB Description: crystal structure of dna polymerase beta complexed with dna and cr-tmppcp

SCOP Domain Sequences for d1huoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huoa2 e.9.1.1 (A:92-334) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekrip
reemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkll
hrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepk
drs

SCOP Domain Coordinates for d1huoa2:

Click to download the PDB-style file with coordinates for d1huoa2.
(The format of our PDB-style files is described here.)

Timeline for d1huoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1huoa1