Lineage for d1ht9b1 (1ht9 B:1-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996351Family a.39.1.1: Calbindin D9K [47474] (2 proteins)
    made of two EF-hands only
  6. 1996352Protein Calbindin D9K [47475] (2 species)
  7. 1996353Species Cow (Bos taurus) [TaxId:9913] [47476] (20 PDB entries)
    Uniprot P02633
  8. 1996359Domain d1ht9b1: 1ht9 B:1-75 [61253]
    Other proteins in same PDB: d1ht9a2, d1ht9b2
    EF-hand swapped dimer
    complexed with ca

Details for d1ht9b1

PDB Entry: 1ht9 (more details), 1.76 Å

PDB Description: domain swapping ef-hands
PDB Compounds: (B:) calbindin d9k

SCOPe Domain Sequences for d1ht9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht9b1 a.39.1.1 (B:1-75) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
kspeelkgifekyaakegdpnnlskeelklllqtefpsllkgmstldelfeeldkngdge
vsfeefqvlvkkisq

SCOPe Domain Coordinates for d1ht9b1:

Click to download the PDB-style file with coordinates for d1ht9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ht9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ht9b2