Lineage for d1ht5b2 (1ht5 B:33-73)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258485Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 2258528Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries)
    Uniprot P05979 32-584
  8. 2258547Domain d1ht5b2: 1ht5 B:33-73 [61247]
    Other proteins in same PDB: d1ht5a1, d1ht5b1
    complexed with bog, fl2, hem, nag

Details for d1ht5b2

PDB Entry: 1ht5 (more details), 2.75 Å

PDB Description: the 2.75 angstrom resolution model of ovine cox-1 complexed with methyl ester flurbiprofen
PDB Compounds: (B:) prostaglandin h2 synthase-1

SCOPe Domain Sequences for d1ht5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht5b2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d1ht5b2:

Click to download the PDB-style file with coordinates for d1ht5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ht5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ht5b1