SCOP 1.59: Domain d1ht5b2: 1ht5 B:33-73

Lineage for d1ht5b2 (1ht5 B:33-73)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (15 PDB entries)

8. Domain d1ht5b2: 1ht5 B:33-73 [61247]
   Other proteins in same PDB: d1ht5a1, d1ht5b1

Details for d1ht5b2

PDB Entry: 1ht5, 2.75 Å

PDB Description: the 2.75 angstrom resolution model of ovine cox-1 complexed with methyl ester flurbiprofen

SCOP Domain Sequences for d1ht5b2:

Sequence; same for both SEQRES and ATOM records:

>d1ht5b2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1ht5b2:

• d1ht5b2 first appeared in SCOP 1.57
  
• d1ht5b2 appears in SCOP 1.61
  
• d1ht5b2 appears in the current release, SCOPe 2.08