Lineage for d1hska1 (1hsk A:15-208)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84620Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 84621Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 84663Family d.145.1.2: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56184] (1 protein)
  6. 84664Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56185] (2 species)
  7. 84670Species Staphylococcus aureus [TaxId:1280] [64416] (1 PDB entry)
  8. 84671Domain d1hska1: 1hsk A:15-208 [61241]
    Other proteins in same PDB: d1hska2

Details for d1hska1

PDB Entry: 1hsk (more details), 2.3 Å

PDB Description: crystal structure of s. aureus murb

SCOP Domain Sequences for d1hska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus}
nkdiyqalqqlipnekikvdeplkrytytktggnadfyitptkneevqavvkyayqneip
vtylgngsniiireggirgivisllsldhievsddaiiagsgaaiidvsrvardyaltgl
efacgipgsiggavymnagayggevkdcidyalcvneqgsliklttkeleldyrnsiiqk
ehlvvleaaftlap

SCOP Domain Coordinates for d1hska1:

Click to download the PDB-style file with coordinates for d1hska1.
(The format of our PDB-style files is described here.)

Timeline for d1hska1:

Domains from same chain:
(mouse over for more information)
d1hska2