Lineage for d1hsja1 (1hsj A:373-487)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079976Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1080037Protein Staphylococcal accessory regulator A homolog, SarR [63472] (1 species)
  7. 1080038Species Staphylococcus aureus [TaxId:1280] [63473] (1 PDB entry)
  8. 1080039Domain d1hsja1: 1hsj A:373-487 [61237]
    Other proteins in same PDB: d1hsja2, d1hsjb2
    Fusion protein with E. coli MBP
    protein/DNA complex; complexed with glc

Details for d1hsja1

PDB Entry: 1hsj (more details), 2.3 Å

PDB Description: sarr mbp fusion structure
PDB Compounds: (A:) fusion protein consisting of staphylococcus accessary regulator protein r and maltose binding protein

SCOPe Domain Sequences for d1hsja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]}
mskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesneisskeiakcsef
kpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqkliseleeyikn

SCOPe Domain Coordinates for d1hsja1:

Click to download the PDB-style file with coordinates for d1hsja1.
(The format of our PDB-style files is described here.)

Timeline for d1hsja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hsja2