SCOP 1.61: Domain d1hr9g1: 1hr9 G:14-233

Lineage for d1hr9g1 (1hr9 G:14-233)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
Domain d1hr9g1: 1hr9 G:14-233 [61224]
Other proteins in same PDB: d1hr9b1, d1hr9b2, d1hr9d1, d1hr9d2, d1hr9f1, d1hr9f2, d1hr9h1, d1hr9h2

Details for d1hr9g1

PDB Entry: 1hr9 (more details), 3.01 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with malate dehydrogenase signal peptide

SCOP Domain Sequences for d1hr9g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr9g1 d.185.1.1 (G:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae)}
artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
fytpentvaafvgvphekaleltgkylgdwqsthppitkk

SCOP Domain Coordinates for d1hr9g1:

Click to download the PDB-style file with coordinates for d1hr9g1.
(The format of our PDB-style files is described here.)

Timeline for d1hr9g1: