SCOPe 2.06: Domain d1hr9a1: 1hr9 A:14-233

Lineage for d1hr9a1 (1hr9 A:14-233)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)

8. Domain d1hr9a1: 1hr9 A:14-233 [61212]
   Other proteins in same PDB: d1hr9b1, d1hr9b2, d1hr9d1, d1hr9d2, d1hr9f1, d1hr9f2, d1hr9f3, d1hr9h1, d1hr9h2
   complexed with epe, zn; mutant

Details for d1hr9a1

PDB Entry: 1hr9, 3.01 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with malate dehydrogenase signal peptide

PDB Compounds: (A:) mitochondrial processing peptidase alpha subunit

SCOPe Domain Sequences for d1hr9a1:

Sequence; same for both SEQRES and ATOM records:

>d1hr9a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
fytpentvaafvgvphekaleltgkylgdwqsthppitkk

Timeline for d1hr9a1:

• d1hr9a1 first appeared in SCOP 1.57
  
• d1hr9a1 appears in SCOPe 2.05
  
• d1hr9a1 appears in SCOPe 2.07
  
• d1hr9a1 appears in the current release, SCOPe 2.08