![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() |
![]() | Family d.185.1.1: MPP-like [63412] (4 proteins) |
![]() | Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries) |
![]() | Domain d1hr8h2: 1hr8 H:246-462 [61211] Other proteins in same PDB: d1hr8a1, d1hr8a2, d1hr8c1, d1hr8c2, d1hr8e1, d1hr8e2, d1hr8g1, d1hr8g2 |
PDB Entry: 1hr8 (more details), 2.7 Å
SCOP Domain Sequences for d1hr8h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr8h2 d.185.1.1 (H:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae)} gplpvfcrgerfikentlptthiaialegvswsapdyfvalatqaivgnwdraigtgtns psplavaasqngslansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriks gkisdaevnrakaqlkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkdd iimwanyrlqnkpvsmvalgntstvpnvsyieeklnq
Timeline for d1hr8h2: