SCOP 1.57: Domain d1hr8c1: 1hr8 C:16-233

Lineage for d1hr8c1 (1hr8 C:16-233)

Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
Domain d1hr8c1: 1hr8 C:16-233 [61200]
Other proteins in same PDB: d1hr8b1, d1hr8b2, d1hr8d1, d1hr8d2, d1hr8f1, d1hr8f2, d1hr8h1, d1hr8h2

Details for d1hr8c1

PDB Entry: 1hr8 (more details), 2.7 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with cytochrome c oxidase iv signal peptide

SCOP Domain Sequences for d1hr8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr8c1 d.185.1.1 (C:16-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae)}
tdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkstehv
egramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelqeq
klsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnkfy
tpentvaafvgvphekaleltgkylgdwqsthppitkk

SCOP Domain Coordinates for d1hr8c1:

Click to download the PDB-style file with coordinates for d1hr8c1.
(The format of our PDB-style files is described here.)

Timeline for d1hr8c1: