Lineage for d1hr8b1 (1hr8 B:24-245)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86102Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 86103Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 86104Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 86179Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species)
  7. 86180Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries)
  8. 86197Domain d1hr8b1: 1hr8 B:24-245 [61198]
    Other proteins in same PDB: d1hr8a1, d1hr8a2, d1hr8c1, d1hr8c2, d1hr8e1, d1hr8e2, d1hr8g1, d1hr8g2

Details for d1hr8b1

PDB Entry: 1hr8 (more details), 2.7 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with cytochrome c oxidase iv signal peptide

SCOP Domain Sequences for d1hr8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr8b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae)}
pgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtqnr
pqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaiere
rdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitkny
kgdrmvlagagavdheklvqyaqkyfghvpksespvplgspr

SCOP Domain Coordinates for d1hr8b1:

Click to download the PDB-style file with coordinates for d1hr8b1.
(The format of our PDB-style files is described here.)

Timeline for d1hr8b1: