Lineage for d1hr6g1 (1hr6 G:14-233)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611059Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2611217Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 2611218Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 2611225Domain d1hr6g1: 1hr6 G:14-233 [61176]
    Other proteins in same PDB: d1hr6b1, d1hr6b2, d1hr6d1, d1hr6d2, d1hr6d3, d1hr6f1, d1hr6f2, d1hr6f3, d1hr6h1, d1hr6h2
    complexed with epe, zn

Details for d1hr6g1

PDB Entry: 1hr6 (more details), 2.5 Å

PDB Description: Yeast Mitochondrial Processing Peptidase
PDB Compounds: (G:) mitochondrial processing peptidase alpha subunit

SCOPe Domain Sequences for d1hr6g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr6g1 d.185.1.1 (G:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
fytpentvaafvgvphekaleltgkylgdwqsthppitkk

SCOPe Domain Coordinates for d1hr6g1:

Click to download the PDB-style file with coordinates for d1hr6g1.
(The format of our PDB-style files is described here.)

Timeline for d1hr6g1: