SCOP 1.57: Domain d1hr6f2: 1hr6 F:246-462

Lineage for d1hr6f2 (1hr6 F:246-462)

Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries)
Domain d1hr6f2: 1hr6 F:246-462 [61175]
Other proteins in same PDB: d1hr6a1, d1hr6a2, d1hr6c1, d1hr6c2, d1hr6e1, d1hr6e2, d1hr6g1, d1hr6g2

Details for d1hr6f2

PDB Entry: 1hr6 (more details), 2.5 Å

PDB Description: Yeast Mitochondrial Processing Peptidase

SCOP Domain Sequences for d1hr6f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr6f2 d.185.1.1 (F:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae)}
gplpvfcrgerfikentlptthiaialegvswsapdyfvalatqaivgnwdraigtgtns
psplavaasqngslansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriks
gkisdaevnrakaqlkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkdd
iimwanyrlqnkpvsmvalgntstvpnvsyieeklnq

SCOP Domain Coordinates for d1hr6f2:

Click to download the PDB-style file with coordinates for d1hr6f2.
(The format of our PDB-style files is described here.)

Timeline for d1hr6f2: