Lineage for d1hr6e2 (1hr6 E:234-468)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86102Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 86103Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 86104Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 86145Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 86146Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 86152Domain d1hr6e2: 1hr6 E:234-468 [61173]
    Other proteins in same PDB: d1hr6b1, d1hr6b2, d1hr6d1, d1hr6d2, d1hr6f1, d1hr6f2, d1hr6h1, d1hr6h2

Details for d1hr6e2

PDB Entry: 1hr6 (more details), 2.5 Å

PDB Description: Yeast Mitochondrial Processing Peptidase

SCOP Domain Sequences for d1hr6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr6e2 d.185.1.1 (E:234-468) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae)}
vaqytggescippapvfgnlpelfhiqigfeglpidhpdiyalatlqtllggggsfsagg
pgkgmysrlythvlnqyyfvencvafnhsysdsgifgislscipqaapqaveviaqqmyn
tfankdlrltedevsraknqlkssllmnlesklveledmgrqvlmhgrkipvnemiskie
dlkpddisrvaemiftgnvnnagngkgratvvmqgdrgsfgdvenvlkayglgns

SCOP Domain Coordinates for d1hr6e2:

Click to download the PDB-style file with coordinates for d1hr6e2.
(The format of our PDB-style files is described here.)

Timeline for d1hr6e2: