Lineage for d1hr6d2 (1hr6 D:246-462)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879393Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 879394Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 879395Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 879578Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species)
  7. 879579Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries)
  8. 879583Domain d1hr6d2: 1hr6 D:246-462 [61171]
    Other proteins in same PDB: d1hr6a1, d1hr6a2, d1hr6c1, d1hr6c2, d1hr6e1, d1hr6e2, d1hr6g1, d1hr6g2

Details for d1hr6d2

PDB Entry: 1hr6 (more details), 2.5 Å

PDB Description: Yeast Mitochondrial Processing Peptidase
PDB Compounds: (D:) mitochondrial processing peptidase beta subunit

SCOP Domain Sequences for d1hr6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr6d2 d.185.1.1 (D:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gplpvfcrgerfikentlptthiaialegvswsapdyfvalatqaivgnwdraigtgtns
psplavaasqngslansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriks
gkisdaevnrakaqlkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkdd
iimwanyrlqnkpvsmvalgntstvpnvsyieeklnq

SCOP Domain Coordinates for d1hr6d2:

Click to download the PDB-style file with coordinates for d1hr6d2.
(The format of our PDB-style files is described here.)

Timeline for d1hr6d2: