Lineage for d1hqub_ (1hqu B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3016822Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 3016866Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (206 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 3017127Domain d1hqub_: 1hqu B: [61159]
    Other proteins in same PDB: d1hqua1
    complexed with hby

Details for d1hqub_

PDB Entry: 1hqu (more details), 2.7 Å

PDB Description: human immunodeficiency virus type 1
PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d1hqub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqub_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

SCOPe Domain Coordinates for d1hqub_:

Click to download the PDB-style file with coordinates for d1hqub_.
(The format of our PDB-style files is described here.)

Timeline for d1hqub_: