Lineage for d1hq8a_ (1hq8 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139425Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 139426Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 139427Family d.169.1.1: C-type lectin domain [56437] (17 proteins)
  6. 139559Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 139565Species Mouse (Mus musculus) [TaxId:10090] [64454] (2 PDB entries)
  8. 139566Domain d1hq8a_: 1hq8 A: [61127]

Details for d1hq8a_

PDB Entry: 1hq8 (more details), 1.95 Å

PDB Description: crystal structure of the murine nk cell-activating receptor nkg2d at 1.95 a

SCOP Domain Sequences for d1hq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus)}
gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
rav

SCOP Domain Coordinates for d1hq8a_:

Click to download the PDB-style file with coordinates for d1hq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hq8a_: