Lineage for d1hq8a_ (1hq8 A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (15 proteins) 
Protein NK cell-activating receptor nkg2d [64453] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [64454] (1 PDB entry) 
Domain d1hq8a_: 1hq8 A: [61127]
Details for d1hq8a_
PDB Entry: 1hq8 (more details), 1.95 Å
PDB Description: crystal structure of the murine nk cell-activating receptor nkg2d at 1.95 a
SCOP Domain Sequences for d1hq8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus)}
gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
rav
SCOP Domain Coordinates for d1hq8a_:
Click to download the PDB-style file with coordinates for d1hq8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hq8a_:
- d1hq8a_ is new in SCOP 1.57
- d1hq8a_ appears in SCOP 1.59
- d1hq8a_ appears in the current release, SCOPe 2.08
View in 3D