Lineage for d1hp6f_ (1hp6 F:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133613Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 133614Family d.58.7.1: Canonical RBD [54929] (13 proteins)
  6. 133688Protein Splicesomal U1A protein [54932] (1 species)
  7. 133689Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries)
  8. 133696Domain d1hp6f_: 1hp6 F: [61116]

Details for d1hp6f_

PDB Entry: 1hp6 (more details), 2.4 Å

PDB Description: crystal structure of a hairpin ribozyme in the catalytically-active conformation

SCOP Domain Sequences for d1hp6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hp6f_ d.58.7.1 (F:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakm

SCOP Domain Coordinates for d1hp6f_:

Click to download the PDB-style file with coordinates for d1hp6f_.
(The format of our PDB-style files is described here.)

Timeline for d1hp6f_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hp6c_