Lineage for d1hmwa3 (1hmw A:336-599)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.30: Supersandwich [49993] (4 superfamilies) Superfamily b.30.3: Hyaluronate lyase-like, central domain [50005] (1 family) 
Family b.30.3.1: Hyaluronate lyase-like, central domain [50006] (2 proteins) 
Protein Chondroitinase AC [50007] (1 species) Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries) 
Domain d1hmwa3: 1hmw A:336-599 [61094]
Other proteins in same PDB: d1hmwa1, d1hmwa2
Details for d1hmwa3
PDB Entry: 1hmw (more details), 2.3 Å
PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis
SCOP Domain Sequences for d1hmwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hmwa3 b.30.3.1 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta
SCOP Domain Coordinates for d1hmwa3:
Click to download the PDB-style file with coordinates for d1hmwa3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hmwa3:
- d1hmwa3 is new in SCOP 1.57
- d1hmwa3 appears in SCOP 1.59
- d1hmwa3 appears in the current release, SCOPe 2.08
View in 3D
