Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries) Uniprot P01130 272-353 |
Domain d1hj7a2: 1hj7 A:334-372 [61072] complexed with ca |
PDB Entry: 1hj7 (more details)
SCOPe Domain Sequences for d1hj7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hj7a2 g.3.11.1 (A:334-372) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} idecqdpdtcsqlcvnleggykcqceegfqldphtkack
Timeline for d1hj7a2: