Lineage for d1hj7a2 (1hj7 A:334-372)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families) 
Family g.3.11.1: EGF-type module [57197] (23 proteins) 
Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
Uniprot P01130 272-353
Domain d1hj7a2: 1hj7 A:334-372 [61072]
complexed with ca
Details for d1hj7a2
PDB Entry: 1hj7 (more details)
PDB Description: nmr study of a pair of ldl receptor ca2+ binding epidermal growth factor-like domains, 20 structures
PDB Compounds: (A:) ldl receptorSCOPe Domain Sequences for d1hj7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hj7a2 g.3.11.1 (A:334-372) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
idecqdpdtcsqlcvnleggykcqceegfqldphtkack
SCOPe Domain Coordinates for d1hj7a2:
Click to download the PDB-style file with coordinates for d1hj7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hj7a2:
- d1hj7a2 first appeared in SCOP 1.57
- d1hj7a2 appears in SCOPe 2.07
View in 3D
